Structure of PDB 4l71 Chain YQ

Receptor sequence

>4l71YQ (length=141) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

MLMPRRMKYRKQQRGRLKGATKGGDYVAFGDYGLVALEPAWITAQQIEAA
RVAMVRHFRRGGKIFIRIFPDKPYTKKPLEVRMGKGKGNVEGYVAVVKPG
RVMFEVAGVTEEQAMEALRIAGHKLPIKTKIVRRDAYDEAQ

3D structure

PDB

4l71 Structural insights into +1 frameshifting promoted by expanded or modification-deficient anticodon stem loops.

Chain

Resolution

3.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	YQ	R5 R6 K8 Y9 K11 Q13 R14 G15 R16 L17 K18 G23 Y26 Q46 A49 R56 K63 R67 F69 Y74 K76 K77 E80 V81 R82 M83 G84 K85 G86 R101 H123 K124 P126 K128 Q141	R5 R6 K8 Y9 K11 Q13 R14 G15 R16 L17 K18 G23 Y26 Q46 A49 R56 K63 R67 F69 Y74 K76 K77 E80 V81 R82 M83 G84 K85 G86 R101 H123 K124 P126 K128 Q141
BS02	rna	YQ	R16 L17	R16 L17

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4l71, PDBe:4l71, PDBj:4l71
PDBsum	4l71
PubMed	25128388
UniProt	P60489\|RL16_THET8 Large ribosomal subunit protein uL16 (Gene Name=rplP)