Structure of PDB 8fom Chain YP

Receptor sequence

>8fomYP (length=150) Species: 300852 (Thermus thermophilus HB8)

MKLSDLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGLKDPRR
FEGGRSTTLMRLPKRGMQGQVPGEIKRPRYQGVNLKDLARFEGEVTPELL
VRAGLLKKGYRLKILGEGEAKPLKVVAHAFSKSALEKLKAAGGEPVLLEA

3D structure

• PDB: 8fom Structural basis for reduced ribosomal A-site fidelity in response to P-site codon-anticodon mismatches.
• Chain: YP
• Resolution: 3.58 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	YP	L3 S4 R7 P8 N9 G11 A12 N13 K14 R15 R16 K17 R18 G20 R21 P23 S25 K29 T30 A31 T32 R33 G34 H35 K36 G37 Q38 K39 S40 R41 S42 L45 K46 D47 R50 F51 E52 G53 G54 R55 S56 L59 M60 P63 K64 G66 M67 G69 Q70 V71 P72 G73 E74 I75 K76 R77 Q81 N84 L105 K107 K108 K113 L115 G116 E117 S131 K132 S133	L3 S4 R7 P8 N9 G11 A12 N13 K14 R15 R16 K17 R18 G20 R21 P23 S25 K29 T30 A31 T32 R33 G34 H35 K36 G37 Q38 K39 S40 R41 S42 L45 K46 D47 R50 F51 E52 G53 G54 R55 S56 L59 M60 P63 K64 G66 M67 G69 Q70 V71 P72 G73 E74 I75 K76 R77 Q81 N84 L105 K107 K108 K113 L115 G116 E117 S131 K132 S133
BS02	MG	YP	A31 T32 R33	A31 T32 R33

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8fom, PDBe:8fom, PDBj:8fom
• PDBsum: 8fom
• PubMed: 36924943
• UniProt: Q5SHQ7|RL15_THET8 Large ribosomal subunit protein uL15 (Gene Name=rplO)