Structure of PDB 6sv4 Chain YP

Receptor sequence

>6sv4YP (length=119) Species: 4932 (Saccharomyces cerevisiae)

AGVKAYELRTKSKEQLASQLVDLKKELAELKVQKLSRPSLPKIKTVRKSI
ACVLTVINEQQREAVRQLYKGKKYQPKDLRAKKTRALRRALTKFEASQVT
EKQRKKQIAFPQRKYAIKA

3D structure

• PDB: 6sv4 RQT complex dissociates ribosomes collided on endogenous RQC substrate SDD1.
• Chain: YP
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	YP	Y75 R81 R86 R90 T93 K94 F95 K103 Q104 K106 K107 K115	Y74 R80 R85 R89 T92 K93 F94 K102 Q103 K105 K106 K114
BS02	rna	YP	K5 A6 Y7 R10 K35 S40 L41 P42 K45 R48 K49 A52 C53 L55 N59 R63 R67 K78 R81 K83 T85 R86 R89	K4 A5 Y6 R9 K34 S39 L40 P41 K44 R47 K48 A51 C52 L54 N58 R62 R66 K77 R80 K82 T84 R85 R88

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6sv4, PDBe:6sv4, PDBj:6sv4
• PDBsum: 6sv4
• PubMed: 32203490
• UniProt: P0CX84|RL35A_YEAST Large ribosomal subunit protein uL29A (Gene Name=RPL35A)