Structure of PDB 6osi Chain YP

Receptor sequence

>6osiYP (length=147) Species: 300852 (Thermus thermophilus HB8)

MKLSDLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGLKDPRR
FEGGRSTTLMRLPKRGMQGQVPGEIKRPRYQGVNLKDLARFEGEVTPELL
VRAGLLKKGYRLKILGEGEAKPLKVVAHAFSKSALEKLKAAGGEPVL

3D structure

• PDB: 6osi Structural insights into mRNA reading frame regulation by tRNA modification and slippery codon-anticodon pairing.
• Chain: YP
• Resolution: 4.14 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	YP	L3 S4 R7 N9 G11 A12 K14 R15 K17 R18 G20 R21 G22 P23 S25 K29 T30 A31 T32 R33 G34 K36 Q38 R41 S42 K46 R50 E52 G53 G54 R55 S56 M60 R61 L62 P63 K64 G66 M67 Q70 V71 P72 G73 E74 I75 R77 N84 L115 K132 S133	L3 S4 R7 N9 G11 A12 K14 R15 K17 R18 G20 R21 G22 P23 S25 K29 T30 A31 T32 R33 G34 K36 Q38 R41 S42 K46 R50 E52 G53 G54 R55 S56 M60 R61 L62 P63 K64 G66 M67 Q70 V71 P72 G73 E74 I75 R77 N84 L115 K132 S133
BS02	MG	YP	G43 G44	G43 G44

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6osi, PDBe:6osi, PDBj:6osi
• PDBsum: 6osi
• PubMed: 33016876
• UniProt: Q5SHQ7|RL15_THET8 Large ribosomal subunit protein uL15 (Gene Name=rplO)