Structure of PDB 6otr Chain YN

Receptor sequence

>6otrYN (length=138) Species: 300852 (Thermus thermophilus HB8)

MKTYVPKQVEPRWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGD
FVVVVNADKIRVTGKKLEQKIYTRYSGYPGGLKKIPLEKMLATHPERVLE
HAVKGMLPKGPLGRRLFKRLKVYAGPDHPHQAQRPEKL

3D structure

• PDB: 6otr Monomeric YoeB toxin retains RNase activity but adopts an obligate dimeric form for thermal stability.
• Chain: YN
• Resolution: 3.12 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	YN	K2 T3 V5 W13 L23 G24 R25 T28 K29 R35 K37 P44 N45 T63 K66 Q69 R74 Y75 S76 Y78 G80 L82 K83 K89 R97 E100 H101 A102 G105 M106 P108 P111 L112 R114 K118	K2 T3 V5 W13 L23 G24 R25 T28 K29 R35 K37 P44 N45 T63 K66 Q69 R74 Y75 S76 Y78 G80 L82 K83 K89 R97 E100 H101 A102 G105 M106 P108 P111 L112 R114 K118

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0017148 negative regulation of translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6otr, PDBe:6otr, PDBj:6otr
• PDBsum: 6otr
• PubMed: 31501867
• UniProt: P60488|RL13_THET8 Large ribosomal subunit protein uL13 (Gene Name=rplM)