Structure of PDB 6bz7 Chain YI

Receptor sequence
>6bz7YI (length=146) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MKVILLEPLENLGDVGQVVDVKPGYARNYLLPRGLAVLATESNLKALEAR
IRAQAKRLAERKAEAERLKEILENLTLTIPVRAGETKIYGSVTAKDIAEA
LSRQHGVTIDPKRLALEKPIKELGEYVLTYKPHPEVPIQLKVSVVA
3D structure
PDB6bz7 Ribosomal ambiguity (ram) mutations promote the open (off) to closed (on) transition and thereby increase miscoding.
ChainYI
Resolution3.68 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna YI E10 R82 K87 Y89 G90 S91 K118 E10 R82 K87 Y89 G90 S91 K118
BS02 rna YI K22 G24 Y25 R27 N28 Y29 R33 S42 K45 R50 K56 K22 G24 Y25 R27 N28 Y29 R33 S42 K45 R50 K56
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6bz7, PDBe:6bz7, PDBj:6bz7
PDBsum6bz7
PubMed30476222
UniProtQ5SLQ1|RL9_THET8 Large ribosomal subunit protein bL9 (Gene Name=rplI)

[Back to BioLiP]