Structure of PDB 6of6 Chain YH

Receptor sequence
>6of6YH (length=170) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
SRIGRLPIPVPKGVSVEVAPGRVKVKGPKGELEVPVSPEMRVVVEEGVVR
VERPSDERRHKSLHGLTRTLIANAVKGVSEGYSKELLIKGIGYRARLVGR
ALELTVGFSHPVVVEPPEGITFEVPEPTRVRVSGIDKQKVGQVAANIRAI
RKPSAYHEKGIYYAGEPVRL
3D structure
PDB6of6 Disruption of evolutionarily correlated tRNA elements impairs accurate decoding.
ChainYH
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna YH R3 I4 R59 K62 S63 L67 T70 N74 I92 F109 S110 K138 Q139 G142 Q143 A146 R152 Y157 H158 R2 I3 R58 K61 S62 L66 T69 N73 I91 F108 S109 K137 Q138 G141 Q142 A145 R151 Y156 H157
BS02 MG YH Y164 A165 Y163 A164
BS03 MG YH N147 I148 R149 A150 I151 N146 I147 R148 A149 I150
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6of6, PDBe:6of6, PDBj:6of6
PDBsum6of6
PubMed32601241
UniProtP0DOY8|RL6_THET8 Large ribosomal subunit protein uL6 (Gene Name=rplF)

[Back to BioLiP]