Structure of PDB 6bz8 Chain YG

Receptor sequence

>6bz8YG (length=181) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

PDB

6bz8 Ribosomal ambiguity (ram) mutations promote the open (off) to closed (on) transition and thereby increase miscoding.

Chain

Resolution

3.74 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	YG	S76 I77 S78 R83	S75 I76 S77 R82
BS02	rna	YG	K36 V38 N40 G42 G44 E45 K47 T71 K74 K75 I77 N79 F80 L82 R91 S124 F125 D126 N132 L133 G134 L135 G154 M155 D156	K35 V37 N39 G41 G43 E44 K46 T70 K73 K74 I76 N78 F79 L81 R90 S123 F124 D125 N131 L132 G133 L134 G153 M154 D155
BS03	rna	YG	P2 W29 Q66 K67 A69 V70 V92 T93 R95 R96 R98	P1 W28 Q65 K66 A68 V69 V91 T92 R94 R95 R97

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6bz8, PDBe:6bz8, PDBj:6bz8
PDBsum	6bz8
PubMed	30476222
UniProt	Q5SHQ0\|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]