Structure of PDB 6bz7 Chain YG

Receptor sequence

>6bz7YG (length=181) Species: 300852 (Thermus thermophilus HB8)

PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

• PDB: 6bz7 Ribosomal ambiguity (ram) mutations promote the open (off) to closed (on) transition and thereby increase miscoding.
• Chain: YG
• Resolution: 3.68 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	YG	S76 I77 S78 R83	S75 I76 S77 R82
BS02	rna	YG	K36 V38 N40 G42 G44 E45 T71 K74 K75 I77 N79 F80 L82 I88 R91 S124 F125 D126 R128 N130 N132 L133 G134 L135 R153 G154 M155 D156	K35 V37 N39 G41 G43 E44 T70 K73 K74 I76 N78 F79 L81 I87 R90 S123 F124 D125 R127 N129 N131 L132 G133 L134 R152 G153 M154 D155
BS03	rna	YG	P2 N27 W29 E30 Q66 K67 P68 A69 V70 R91 V92 T93 R95 R96 R98	P1 N26 W28 E29 Q65 K66 P67 A68 V69 R90 V91 T92 R94 R95 R97

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6bz7, PDBe:6bz7, PDBj:6bz7
• PDBsum: 6bz7
• PubMed: 30476222
• UniProt: Q5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)