Structure of PDB 6buw Chain YG

Receptor sequence

>6buwYG (length=181) Species: 300852 (Thermus thermophilus HB8)

PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

• PDB: 6buw Ribosomal ambiguity (ram) mutations promote the open (off) to closed (on) transition and thereby increase miscoding.
• Chain: YG
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	YG	S76 S78	S75 S77
BS02	rna	YG	K36 V38 N40 G42 G44 E45 T71 A73 K74 I77 N79 F80 L82 I88 R91 S124 D126 R128 N130 N132 L133 L135 R136 R153 G154 M155 D156	K35 V37 N39 G41 G43 E44 T70 A72 K73 I76 N78 F79 L81 I87 R90 S123 D125 R127 N129 N131 L132 L134 R135 R152 G153 M154 D155
BS03	rna	YG	P2 N27 W29 E30 K67 A69 V70 V92 T93 R95 R96 R98	P1 N26 W28 E29 K66 A68 V69 V91 T92 R94 R95 R97

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6buw, PDBe:6buw, PDBj:6buw
• PDBsum: 6buw
• PubMed: 30476222
• UniProt: Q5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)