Structure of PDB 5j3c Chain YG

Receptor sequence

>5j3cYG (length=181) Species: 300852 (Thermus thermophilus HB8)

PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

• PDB: 5j3c Uniformity of Peptide Release Is Maintained by Methylation of Release Factors.
• Chain: YG
• Resolution: 3.04 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	YG	V38 N40 G42 L43 T71 A73 K75 I77 N79 F80 I88 S124 D126 R128 N132 L135 D156 A158	V37 N39 G41 L42 T70 A72 K74 I76 N78 F79 I87 S123 D125 R127 N131 L134 D155 A157
BS02	rna	YG	N27 W29 Q66 K67 A69 V70 R91 V92 T93 R95 R96	N26 W28 Q65 K66 A68 V69 R90 V91 T92 R94 R95
BS03	rna	YG	S76 I77 S78	S75 I76 S77
BS04	MG	YG	N123 F125	N122 F124
BS05	MG	YG	R128 G129 N130 T161	R127 G128 N129 T160

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5j3c, PDBe:5j3c, PDBj:5j3c
• PDBsum: 5j3c
• PubMed: 27681416
• UniProt: Q5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)