Structure of PDB 4l47 Chain YG

Receptor sequence
>4l47YG (length=181) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK
3D structure
PDB4l47 Structural insights into +1 frameshifting promoted by expanded or modification-deficient anticodon stem loops.
ChainYG
Resolution3.22 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna YG K36 N40 G42 G44 E45 T71 A73 K74 I77 L82 R91 S124 D126 R128 N132 D156 K35 N39 G41 G43 E44 T70 A72 K73 I76 L81 R90 S123 D125 R127 N131 D155
BS02 rna YG P2 N27 V28 W29 E30 Q66 K67 A69 V70 R91 V92 T93 R95 R98 P1 N26 V27 W28 E29 Q65 K66 A68 V69 R90 V91 T92 R94 R97
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4l47, PDBe:4l47, PDBj:4l47
PDBsum4l47
PubMed25128388
UniProtQ5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]