Structure of PDB 6osi Chain YF

Receptor sequence

>6osiYF (length=202) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

VYQIPVLSPSGRRELAADLPAEINPHLLWEVVRWQLAKRRRGTASTKTRG
EVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKPRDYSYTLPKKV
RKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDGSESVL
LVTGNELVRRAARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWEVFQNR
IG

3D structure

PDB

6osi Structural insights into mRNA reading frame regulation by tRNA modification and slippery codon-anticodon pairing.

Chain

Resolution

4.14 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	YF	H31 R38 Q40 K43 R44 R45 R46 T48 S50 K52 T53 R54 V57 A58 Y59 S60 R62 K63 Q67 K68 H69 R74 H75 I82 V84 G85 V89 F90 Y99 T100 P102 K103 K104 R106 K108 T136 R165 R168 N169 T175 L176 N182	H26 R33 Q35 K38 R39 R40 R41 T43 S45 K47 T48 R49 V52 A53 Y54 S55 R57 K58 Q62 K63 H64 R69 H70 I77 V79 G80 V84 F85 Y94 T95 P97 K98 K99 R101 K103 T131 R160 R163 N164 T170 L171 N177

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6osi, PDBe:6osi, PDBj:6osi
PDBsum	6osi
PubMed	33016876
UniProt	Q5SHN9\|RL4_THET8 Large ribosomal subunit protein uL4 (Gene Name=rplD)

[Back to BioLiP]