Structure of PDB 4zsn Chain YF

Receptor sequence

>4zsnYF (length=208) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

MKEVAVYQIPVLSPSGRRELAADLPAEINPHLLWEVVRWQLAKRRRGTAS
TKTRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKPRDYSYT
LPKKVRKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDG
SESVLLVTGNELVRRAARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWE
VFQNRIGG

3D structure

PDB

4zsn Mechanism of endonuclease cleavage by the HigB toxin.

Chain

Resolution

3.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	YF	H31 L32 E35 R38 W39 Q40 L41 R44 R45 R46 T48 A49 S50 T51 K52 T53 R54 G55 V57 A58 Y59 S60 R62 K63 Q67 K68 H69 G71 R72 A73 R74 H75 G76 P81 I82 F83 V84 V88 V89 F90 P92 R95 Y99 T100 P102 K103 K104 V105 R106 K135 T136 K137 R165 R168 N169 P171 L176 G180 N182 Y184 R205	H31 L32 E35 R38 W39 Q40 L41 R44 R45 R46 T48 A49 S50 T51 K52 T53 R54 G55 V57 A58 Y59 S60 R62 K63 Q67 K68 H69 G71 R72 A73 R74 H75 G76 P81 I82 F83 V84 V88 V89 F90 P92 R95 Y99 T100 P102 K103 K104 V105 R106 K135 T136 K137 R165 R168 N169 P171 L176 G180 N182 Y184 R205
BS02	MG	YF	R168 V173	R168 V173

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4zsn, PDBe:4zsn, PDBj:4zsn
PDBsum	4zsn
PubMed	27378776
UniProt	Q5SHN9\|RL4_THET8 Large ribosomal subunit protein uL4 (Gene Name=rplD)

[Back to BioLiP]