Structure of PDB 6nta Chain YE

Receptor sequence

>6ntaYE (length=204) Species: 300852 (Thermus thermophilus HB8)

MKGILGVKVGMTRIFRDDRAVPVTVILAGPCPVVQRRTPEKDGYTAVQLG
FLPQNPKRVNRPLKGHFAKAGVEPVRILREIRDFNPEGDTVTVEIFKPGE
RVDVTGTSKGRGFAGVMKRWNFAGGPDSHGAHKIHRHPGSIGNRKTPGRV
YKGKKMAGHYGAERVTVMNLEVVDVIPEENLLLVKGAVPGPNGGLVIVRE
TKKA

3D structure

• PDB: 6nta Structural insights into mRNA reading frame regulation by tRNA modification and slippery codon-anticodon pairing.
• Chain: YE
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	YE	M11 T12 R13 P22 Q35 R37 K41 D42 Y44 R58 N60 R61 P62 L63 G65 H66 K69 R76 L78 R79 E80 R82 K109 G110 R111 G112 F113 G115 K118 R119 F122 S128 H129 G130 H132 K133 I134 H135 R136 H137 P138 G139 S140 I141 G142 N143 R144 K145 T146 P147 G148 R149 V150 Y151 K152 K154 M156 A157 H159 Y160 R164 V165 T166 M168 N169 L170 G186 V188 P189 P191 N192 K202 K203 A204	M11 T12 R13 P22 Q35 R37 K41 D42 Y44 R58 N60 R61 P62 L63 G65 H66 K69 R76 L78 R79 E80 R82 K109 G110 R111 G112 F113 G115 K118 R119 F122 S128 H129 G130 H132 K133 I134 H135 R136 H137 P138 G139 S140 I141 G142 N143 R144 K145 T146 P147 G148 R149 V150 Y151 K152 K154 M156 A157 H159 Y160 R164 V165 T166 M168 N169 L170 G186 V188 P189 P191 N192 K202 K203 A204
BS02	MG	YE	K118 R119 Y160	K118 R119 Y160
BS03	MG	YE	R37 Y44	R37 Y44

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6nta, PDBe:6nta, PDBj:6nta
• PDBsum: 6nta
• PubMed: 33016876
• UniProt: Q5SHN8|RL3_THET8 Large ribosomal subunit protein uL3 (Gene Name=rplC)