Structure of PDB 6i7o Chain YD

Receptor sequence

>6i7oYD (length=209) Species: 4932 (Saccharomyces cerevisiae)

ARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVH
LVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINK
QGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEGLRRARYKFPGQ
QKIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLSKKGSLENNIRE
FPEYFAAQA

3D structure

• PDB: 6i7o Collided ribosomes form a unique structural interface to induce Hel2-driven quality control pathways.
• Chain: YD
• Resolution: 5.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	YD	R3 R4 P5 A6 R7 C8 R10 K13 N14 K15 P16 Y17 Y22 D35 K39 K40 S61 E63 A64 R88 R90 H92 F94 R98 I99 N100 M115 R116 G117 W119 G120 Q133 R153 R154 Y157 K158 P160 D193 G194 F196 K198	R2 R3 P4 A5 R6 C7 R9 K12 N13 K14 P15 Y16 Y21 D34 K38 K39 S60 E62 A63 R87 R89 H91 F93 R97 I98 N99 M103 R104 G105 W107 G108 Q121 R141 R142 Y145 K146 P148 D181 G182 F184 K186
BS02	rna	YD	Y11 E56 K202 K203 G204 S205 L206 F217	Y10 E55 K190 K191 G192 S193 L194 F205

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0006415 translational termination

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6i7o, PDBe:6i7o, PDBj:6i7o
• PDBsum: 6i7o
• PubMed: 30609991
• UniProt: P41805|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)