Structure of PDB 5j30 Chain YD

Receptor sequence
>5j30YD (length=275) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
AVKKFKPYTPSRRFMTVADFSEITKTEPEKSLVKPLKKTGGRNNQGRITV
RFRGGGHKRLYRIIDFKRWDKVGIPAKVAAIEYDPNRSARIALLHYVDGE
KRYIIAPDGLQVGQQVVAGPDAPIQVGNALPLRFIPVGTVVHAVELEPKK
GAKLARAAGTSAQIQGREGDYVILRLPSGELRKVHGECYATVGAVGNADH
KNIVLGKAGRSRWLGRRPHVRGAAMNPVDHPHGGGEGRAPRGRPPASPWG
WQTKGLKTRKRRKPSSRFIIARRKK
3D structure
PDB5j30 Uniformity of Peptide Release Is Maintained by Methylation of Release Factors.
ChainYD
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna YD K7 P8 Y9 T10 S12 R13 R14 F15 F21 K31 K35 P36 L37 K38 K39 T40 G42 R43 N44 N45 Q46 G47 R48 I49 T50 V51 R52 R54 G55 G56 H58 K59 R60 L61 Y62 R63 Y84 P86 R88 D99 G100 E101 K102 E148 P149 K151 K154 L155 A156 R157 A158 A159 G160 Y172 L177 P178 S179 E181 R183 A199 H201 K202 V205 L206 G207 K208 A209 G210 R211 S212 R213 W214 L215 R218 P219 H220 V221 R222 G223 A224 A225 M226 N227 P228 V229 D230 H231 H233 G236 E237 G238 R239 A240 P241 R242 G243 R244 P246 A247 S248 P249 W250 W252 Q253 T254 K255 G256 L257 K258 T259 R260 K261 R263 K264 S266 F269 R273 R274 K6 P7 Y8 T9 S11 R12 R13 F14 F20 K30 K34 P35 L36 K37 K38 T39 G41 R42 N43 N44 Q45 G46 R47 I48 T49 V50 R51 R53 G54 G55 H57 K58 R59 L60 Y61 R62 Y83 P85 R87 D98 G99 E100 K101 E147 P148 K150 K153 L154 A155 R156 A157 A158 G159 Y171 L176 P177 S178 E180 R182 A198 H200 K201 V204 L205 G206 K207 A208 G209 R210 S211 R212 W213 L214 R217 P218 H219 V220 R221 G222 A223 A224 M225 N226 P227 V228 D229 H230 H232 G235 E236 G237 R238 A239 P240 R241 G242 R243 P245 A246 S247 P248 W249 W251 Q252 T253 K254 G255 L256 K257 T258 R259 K260 R262 K263 S265 F268 R272 R273
BS02 rna YD Q166 K202 K276 Q165 K201 K275
BS03 MG YD P241 R242 P240 R241
BS04 MG YD H58 R60 W214 L215 H57 R59 W213 L214
BS05 MG YD P11 R14 P10 R13
BS06 MG YD R52 F53 R54 R51 F52 R53
BS07 MG YD A240 P241 A239 P240
BS08 MG YD Y62 R63 D85 N87 R88 Y61 R62 D84 N86 R87
BS09 MG YD R217 R218 P219 R216 R217 P218
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0016740 transferase activity
GO:0019843 rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5j30, PDBe:5j30, PDBj:5j30
PDBsum5j30
PubMed27681416
UniProtP60405|RL2_THET8 Large ribosomal subunit protein uL2 (Gene Name=rplB)

[Back to BioLiP]