Structure of PDB 6nwy Chain Y9

Receptor sequence

>6nwyY9 (length=37) Species: 300852 (Thermus thermophilus HB8)

MKVRASVKRICDKCKVIRRHGRVYVICENPKHKQRQG

3D structure

• PDB: 6nwy Structural insights into mRNA reading frame regulation by tRNA modification and slippery codon-anticodon pairing.
• Chain: Y9
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Y9	M1 V3 A5 S6 V7 K8 R19 H20 K31 K33 R35 Q36	M1 V3 A5 S6 V7 K8 R19 H20 K31 K33 R35 Q36
BS02	ZN	Y9	C14 C27 H32	C14 C27 H32

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0046872 metal ion binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6nwy, PDBe:6nwy, PDBj:6nwy
• PDBsum: 6nwy
• PubMed: 33016876
• UniProt: Q5SHR2|RL36_THET8 Large ribosomal subunit protein bL36 (Gene Name=rpmJ)