Structure of PDB 6bz7 Chain Y9

Receptor sequence
>6bz7Y9 (length=37) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MKVRASVKRICDKCKVIRRHGRVYVICENPKHKQRQG
3D structure
PDB6bz7 Ribosomal ambiguity (ram) mutations promote the open (off) to closed (on) transition and thereby increase miscoding.
ChainY9
Resolution3.68 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Y9 M1 K2 V3 R4 A5 D12 K13 C14 K15 I17 R18 R19 R22 Y24 V25 I26 C27 E28 N29 P30 K31 H32 K33 R35 Q36 G37 M1 K2 V3 R4 A5 D12 K13 C14 K15 I17 R18 R19 R22 Y24 V25 I26 C27 E28 N29 P30 K31 H32 K33 R35 Q36 G37
BS02 MG Y9 V7 Q36 V7 Q36
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6bz7, PDBe:6bz7, PDBj:6bz7
PDBsum6bz7
PubMed30476222
UniProtQ5SHR2|RL36_THET8 Large ribosomal subunit protein bL36 (Gene Name=rpmJ)

[Back to BioLiP]