Structure of PDB 4lel Chain Y8

Receptor sequence
>4lelY8 (length=64) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
PKMKTHKGAKKRVKITASGKVVAMKTGKRHLNWQKSGKEIRQKGRKFVLA
KPEAERIKLLLPYE
3D structure
PDB4lel Structural insights into +1 frameshifting promoted by expanded or modification-deficient anticodon stem loops.
ChainY8
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna Y8 P2 K3 M4 K5 T6 K8 K12 R13 T17 A18 S19 K21 K26 T27 K29 R30 H31 L32 N33 W34 G38 K39 R42 R46 F48 V49 K52 L61 L62 Y64 E65 P1 K2 M3 K4 T5 K7 K11 R12 T16 A17 S18 K20 K25 T26 K28 R29 H30 L31 N32 W33 G37 K38 R41 R45 F47 V48 K51 L60 L61 Y63 E64
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4lel, PDBe:4lel, PDBj:4lel
PDBsum4lel
PubMed25128388
UniProtQ5SKU1|RL35_THET8 Large ribosomal subunit protein bL35 (Gene Name=rpmI)

[Back to BioLiP]