Structure of PDB 5vpp Chain Y7

Receptor sequence

>5vppY7 (length=49) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

MKRTWQPNRRKRAKTHGFRARMRTPGGRKVLKRRRQKGRWRLTPAVRKR

3D structure

PDB

5vpp Mechanism of tRNA-mediated +1 ribosomal frameshifting.

Chain

Resolution

3.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Y7	M1 K2 R3 T4 W5 Q6 P7 N8 R9 R10 K11 R12 A13 K14 T15 H16 G17 F18 R19 R21 K29 K32 R33 R34 R35 Q36 K37 G38 R39 W40 R41 R47 K48 R49	M1 K2 R3 T4 W5 Q6 P7 N8 R9 R10 K11 R12 A13 K14 T15 H16 G17 F18 R19 R21 K29 K32 R33 R34 R35 Q36 K37 G38 R39 W40 R41 R47 K48 R49

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:5vpp, PDBe:5vpp, PDBj:5vpp
PDBsum	5vpp
PubMed	30262649
UniProt	P80340\|RL34_THET8 Large ribosomal subunit protein bL34 (Gene Name=rpmH)