Structure of PDB 4lfz Chain Y7

Receptor sequence
>4lfzY7 (length=49) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MKRTWQPNRRKRAKTHGFRARMRTPGGRKVLKRRRQKGRWRLTPAVRKR
3D structure
PDB4lfz Structural insights into +1 frameshifting promoted by expanded or modification-deficient anticodon stem loops.
ChainY7
Resolution3.92 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Y7 M1 K2 R3 T4 W5 Q6 P7 N8 R9 R10 K11 R12 A13 H16 G17 F18 R19 R21 K29 K32 R33 R34 R35 Q36 K37 R39 W40 R41 R47 K48 R49 M1 K2 R3 T4 W5 Q6 P7 N8 R9 R10 K11 R12 A13 H16 G17 F18 R19 R21 K29 K32 R33 R34 R35 Q36 K37 R39 W40 R41 R47 K48 R49
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4lfz, PDBe:4lfz, PDBj:4lfz
PDBsum4lfz
PubMed25128388
UniProtP80340|RL34_THET8 Large ribosomal subunit protein bL34 (Gene Name=rpmH)

[Back to BioLiP]