Structure of PDB 6oxi Chain Y6

Receptor sequence
>6oxiY6 (length=53) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
ASEVRIKLLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHRE
VKI
3D structure
PDB6oxi Monomeric YoeB toxin retains RNase activity but adopts an obligate dimeric form for thermal stability.
ChainY6
Resolution3.495 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Y6 A2 R6 K8 R18 Y21 K25 N26 L36 R37 K38 Y39 W42 H46 A1 R5 K7 R17 Y20 K24 N25 L35 R36 K37 Y38 W41 H45
BS02 ZN Y6 C13 C40 C12 C39
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6oxi, PDBe:6oxi, PDBj:6oxi
PDBsum6oxi
PubMed31501867
UniProtP35871|RL33_THET8 Large ribosomal subunit protein bL33 (Gene Name=rpmG)

[Back to BioLiP]