Structure of PDB 6oxa Chain Y6

Receptor sequence
>6oxaY6 (length=53) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
ASEVRIKLLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHRE
VKI
3D structure
PDB6oxa Monomeric YoeB toxin retains RNase activity but adopts an obligate dimeric form for thermal stability.
ChainY6
Resolution3.25 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna Y6 A2 S3 R6 Y21 T23 E24 N26 N29 L36 R37 K38 Y39 R44 H46 A1 S2 R5 Y20 T22 E23 N25 N28 L35 R36 K37 Y38 R43 H45
BS02 ZN Y6 C13 C16 C40 C12 C15 C39
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6oxa, PDBe:6oxa, PDBj:6oxa
PDBsum6oxa
PubMed31501867
UniProtP35871|RL33_THET8 Large ribosomal subunit protein bL33 (Gene Name=rpmG)

[Back to BioLiP]