Structure of PDB 6osi Chain Y6

Receptor sequence
>6osiY6 (length=53) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
ASEVRIKLLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHRE
VKI
3D structure
PDB6osi Structural insights into mRNA reading frame regulation by tRNA modification and slippery codon-anticodon pairing.
ChainY6
Resolution4.14 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Y6 R6 R19 Y21 T23 E24 N29 R37 Y39 H46 R5 R18 Y20 T22 E23 N28 R36 Y38 H45
BS02 ZN Y6 C13 C40 C43 C12 C39 C42
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6osi, PDBe:6osi, PDBj:6osi
PDBsum6osi
PubMed33016876
UniProtP35871|RL33_THET8 Large ribosomal subunit protein bL33 (Gene Name=rpmG)

[Back to BioLiP]