Structure of PDB 7y4l Chain Y5

Receptor sequence

>7y4lY5 (length=177) Species: 35688 (Porphyridium purpureum) [Search protein sequence]

MLDAFSRVVVNSDAKAAYVGGSDLQALKSFIADGNKRLDAVNSIVSNASC
MVSDAVSGMICENPGLISPGGNCYTNRRMAACLRDGEIILRYVSYALLAG
DASVLEDRCLNGLKETYIALGVPTNSSIRAVSIMKAQAVAFITNTATERK
MSFAAGDCTSLASEVASYFDRVGAAIS

3D structure

PDB

7y4l In situ structure of the red algal phycobilisome-PSII-PSI-LHC megacomplex.

Chain

Resolution

3.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	PEB	Y5	Y74 N76	Y74 N76
BS02	PEB	Y5	N35 K36 L38 D39 N42 I142 A154 A155 C158	N35 K36 L38 D39 N42 I142 A154 A155 C158
BS03	PEB	Y5	C50 D54 S57 C61 Q137 T145 T147 E148	C50 D54 S57 C61 Q137 T145 T147 E148
BS04	PEB	Y5	N72 R77 R78 A81 C82 D85 I88 Y92 C109 L113 S126	N72 R77 R78 A81 C82 D85 I88 Y92 C109 L113 S126

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane
GO:0030089	phycobilisome

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7y4l, PDBe:7y4l, PDBj:7y4l
PDBsum	7y4l
PubMed	36922595
UniProt	P11393\|PHEB_PORPP B-phycoerythrin beta chain (Gene Name=cpeB)

[Back to BioLiP]