Structure of PDB 5m1j Chain Y5

Receptor sequence

>5m1jY5 (length=126) Species: 4932 (Saccharomyces cerevisiae)

AKQSLDVSSDRRKARKAYFTAPSSQRRVLLSAPLSKELRAQYGIKALPIR
RDDEVLVVRGSKKGQEGKISSVYRLKFAVQVDKVTKEKVNGASVPINLHP
SKLVITKLHLDKDRKALIQRKGGKLE

3D structure

• PDB: 5m1j Structural insights into ribosomal rescue by Dom34 and Hbs1 at near-atomic resolution.
• Chain: Y5
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Y5	A2 Q4 S5 D7 S9 S10 R12 K14 A15 R16 Y19 V29 P34 R40 K46 A47 R60 G61 S62 K77 K87 K89 N91 H100 S102 K103 K122	A1 Q3 S4 D6 S8 S9 R11 K13 A14 R15 Y18 V28 P33 R39 K45 A46 R59 G60 S61 K76 K86 K88 N90 H99 S101 K102 K121
BS02	rna	Y5	R12 R13 R16 K17 P23 S24 S25 R28 R51 R52 V73 Y74 R75 L76 K113 D114 R115 R121	R11 R12 R15 K16 P22 S23 S24 R27 R50 R51 V72 Y73 R74 L75 K112 D113 R114 R120
BS03	MG	Y5	R75 L76	R74 L75

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0042273 ribosomal large subunit biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:0032991 protein-containing complex
• GO:0043232 intracellular non-membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5m1j, PDBe:5m1j, PDBj:5m1j
• PDBsum: 5m1j
• PubMed: 27995908
• UniProt: P05743|RL26A_YEAST Large ribosomal subunit protein uL24A (Gene Name=RPL26A)