Structure of PDB 4tuc Chain Y5

Receptor sequence
>4tucY5 (length=58) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
KHPVPKKKTSKARRDARRSHHALTPPTLVPCPECKAMKPPHTVCPECGYY
AGRKVLEV
3D structure
PDB4tuc Structural insights into translational recoding by frameshift suppressor tRNASufJ.
ChainY5
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Y5 K3 H4 P5 V6 P7 K8 K9 K10 T11 S12 K13 A14 R15 R16 D17 A18 R19 R20 S21 H22 H23 T29 P42 H43 Y51 Y52 K1 H2 P3 V4 P5 K6 K7 K8 T9 S10 K11 A12 R13 R14 D15 A16 R17 R18 S19 H20 H21 T27 P40 H41 Y49 Y50
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4tuc, PDBe:4tuc, PDBj:4tuc
PDBsum4tuc
PubMed25352689
UniProtP80339|RL32_THET8 Large ribosomal subunit protein bL32 (Gene Name=rpmF)

[Back to BioLiP]