Structure of PDB 6of6 Chain Y4

Receptor sequence
>6of6Y4 (length=71) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MKEGIHPKLVPARIICGCGNVIETYSTKPEIYVEVCSKCHPFYTGQQRFV
DTEGRVERFQRRYGDSYRKGR
3D structure
PDB6of6 Disruption of evolutionarily correlated tRNA elements impairs accurate decoding.
ChainY4
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Y4 Y67 G70 R71 Y67 G70 R71
BS02 rna Y4 M1 K2 M1 K2
BS03 MG Y4 F49 V50 F49 V50
BS04 MG Y4 M1 H6 M1 H6
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6of6, PDBe:6of6, PDBj:6of6
PDBsum6of6
PubMed32601241
UniProtQ5SJE1|RL31_THET8 Large ribosomal subunit protein bL31 (Gene Name=rpmE)

[Back to BioLiP]