Structure of PDB 5vpo Chain Y4 |
>5vpoY4 (length=71) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] |
MKEGIHPKLVPARIICGCGNVIETYSTKPEIYVEVCSKCHPFYTGQQRFV DTEGRVERFQRRYGDSYRKGR |
|
PDB | 5vpo Mechanism of tRNA-mediated +1 ribosomal frameshifting. |
Chain | Y4 |
Resolution | 3.34 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
Y4 |
M1 K2 |
M1 K2 |
|
|
|
|