Structure of PDB 7r81 Chain Y2

Receptor sequence

>7r81Y2 (length=144) Species: 5141 (Neurospora crassa)

SGGKPRGLNAARKLRNNRREQRWSDLHYKKRALGTAFKSSPFGGSSHAKG
IVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDE
VLLAGFGRKGKAKGDIPGVRFKVVKVSGVGLLALWKEKKEKPRS

3D structure

• PDB: 7r81 Structure of the translating Neurospora ribosome arrested by cycloheximide
• Chain: Y2
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Y2	S2 G3 G4 K5 P6 R7 G8 N10 R13 K14 R19 R20 Q22 R23 W24 S25 D26 K30 R32 F38 K39 S40 S46 S47 A49 K50 E60 K62 Q63 N65 S66 A67 I68 R69 K70 N89 D90 L103 G106 G108 R109 K110 K112 K114 G115 D116 R121 K126 K140	S1 G2 G3 K4 P5 R6 G7 N9 R12 K13 R18 R19 Q21 R22 W23 S24 D25 K29 R31 F37 K38 S39 S45 S46 A48 K49 E59 K61 Q62 N64 S65 A66 I67 R68 K69 N88 D89 L102 G105 G107 R108 K109 K111 K113 G114 D115 R120 K125 K139
BS02	rna	Y2	Q63 P64	Q62 P63

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7r81, PDBe:7r81, PDBj:7r81
• PDBsum: 7r81
• PubMed: 34815343
• UniProt: Q9HE74|RS23_NEUCR Small ribosomal subunit protein uS12 (Gene Name=crp-28)