Structure of PDB 7r81 Chain Y1

Receptor sequence
>7r81Y1 (length=61) Species: 5141 (Neurospora crassa) [Search protein sequence]
MRTYDDTFSGQRIYPGKGKLYVRGDSKIFRFQNGKSESLFLQRKNPRRIA
WTVLYRRQHKK
3D structure
PDB7r81 Structure of the translating Neurospora ribosome arrested by cycloheximide
ChainY1
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Y1 K19 K35 S38 L39 Q42 R43 K44 R48 I49 A50 W51 R56 K61 K19 K35 S38 L39 Q42 R43 K44 R48 I49 A50 W51 R56 K61
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7r81, PDBe:7r81, PDBj:7r81
PDBsum7r81
PubMed34815343
UniProtQ7SDU2|RL24_NEUCR Large ribosomal subunit protein eL24 (Gene Name=rpl-24)

[Back to BioLiP]