Structure of PDB 6osi Chain Y1

Receptor sequence
>6osiY1 (length=93) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
SKVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRV
RVAGQEITFRVAASHIPKVYELVERAKGLKLEGLSPKEIKKEL
3D structure
PDB6osi Structural insights into mRNA reading frame regulation by tRNA modification and slippery codon-anticodon pairing.
ChainY1
Resolution4.14 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Y1 S2 K3 K10 I13 A15 N16 K25 G29 T34 T35 K39 R40 R41 Q42 Y43 P44 N45 Q47 R52 R61 H66 K69 R76 K78 S1 K2 K9 I12 A14 N15 K24 G28 T33 T34 K38 R39 R40 Q41 Y42 P43 N44 Q46 R51 R60 H65 K68 R75 K77
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6osi, PDBe:6osi, PDBj:6osi
PDBsum6osi
PubMed33016876
UniProtP60494|RL28_THET8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)

[Back to BioLiP]