Structure of PDB 4lfz Chain Y1

Receptor sequence

>4lfzY1 (length=97) Species: 300852 (Thermus thermophilus HB8)

SKVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRV
RVAGQEITFRVAASHIPKVYELVERAKGLKLEGLSPKEIKKELLKLL

3D structure

• PDB: 4lfz Structural insights into +1 frameshifting promoted by expanded or modification-deficient anticodon stem loops.
• Chain: Y1
• Resolution: 3.92 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Y1	S2 K3 K10 I13 V14 A15 N16 I18 Q19 R20 K25 G28 V30 K32 K33 T34 T35 K39 R40 R41 Q42 Y43 P44 N45 Q47 R50 R52 R61 S65 H66 K69 K78 K88 E93 L94 L97 L98	S1 K2 K9 I12 V13 A14 N15 I17 Q18 R19 K24 G27 V29 K31 K32 T33 T34 K38 R39 R40 Q41 Y42 P43 N44 Q46 R49 R51 R60 S64 H65 K68 K77 K87 E92 L93 L96 L97

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4lfz, PDBe:4lfz, PDBj:4lfz
• PDBsum: 4lfz
• PubMed: 25128388
• UniProt: P60494|RL28_THET8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)