Structure of PDB 6osi Chain Y0

Receptor sequence

>6osiY0 (length=82) Species: 300852 (Thermus thermophilus HB8)

AHKKGLGSTRNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNV
GMGRDFTLFALVDGVVEFQDRGRLGRYVHVRP

3D structure

• PDB: 6osi Structural insights into mRNA reading frame regulation by tRNA modification and slippery codon-anticodon pairing.
• Chain: Y0
• Resolution: 4.14 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Y0	H3 K4 T10 N12 R14 D15 S16 Q17 A18 K19 R20 K24 Y26 E27 G28 Q29 A33 G34 N35 I36 R39 R41 G42 T43 G54 R55 D56 F57 F60 F69 R74 R77	H2 K3 T9 N11 R13 D14 S15 Q16 A17 K18 R19 K23 Y25 E26 G27 Q28 A32 G33 N34 I35 R38 R40 G41 T42 G53 R54 D55 F56 F59 F68 R73 R76
BS02	rna	Y0	R72 R74	R71 R73

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6osi, PDBe:6osi, PDBj:6osi
• PDBsum: 6osi
• PubMed: 33016876
• UniProt: P60493|RL27_THET8 Large ribosomal subunit protein bL27 (Gene Name=rpmA)