Structure of PDB 6ndk Chain Y0

Receptor sequence

>6ndkY0 (length=77) Species: 300852 (Thermus thermophilus HB8)

GSTRNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVGMGRDF
TLFALVDGVVEFQDRGRLGRYVHVRPL

3D structure

• PDB: 6ndk Importance of a tRNA anticodon loop modification and a conserved, noncanonical anticodon stem pairing intRNACGGProfor decoding
• Chain: Y0
• Resolution: 3.64 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Y0	N12 R14 S16 Q17 A18 K19 R20 K24 R25 Y26 E27 Q29 A33 G34 N35 I36 R39 R41 G42 T43 R44 G54 R55 D56 F57 F60 L62 F69 R74 L75 R77	N5 R7 S9 Q10 A11 K12 R13 K17 R18 Y19 E20 Q22 A26 G27 N28 I29 R32 R34 G35 T36 R37 G47 R48 D49 F50 F53 L55 F62 R67 L68 R70
BS02	rna	Y0	R72 R74	R65 R67

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6ndk, PDBe:6ndk, PDBj:6ndk
• PDBsum: 6ndk
• PubMed: 30782843
• UniProt: P60493|RL27_THET8 Large ribosomal subunit protein bL27 (Gene Name=rpmA)