Structure of PDB 4w4g Chain Y0

Receptor sequence

>4w4gY0 (length=83) Species: 300852 (Thermus thermophilus HB8)

HKKGLGSTRNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVG
MGRDFTLFALVDGVVEFQDRGRLGRYVHVRPLA

3D structure

• PDB: 4w4g Defining the mRNA recognition signature of a bacterial toxin protein.
• Chain: Y0
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Y0	L7 R11	L5 R9
BS02	rna	Y0	H3 K5 N12 R14 D15 S16 Q17 A18 K19 R20 V23 K24 Y26 E27 Q29 A33 G34 N35 I36 R39 R41 G42 T43 F45 G54 R55 D56 F57 F60 F69 R74 L75 R77	H1 K3 N10 R12 D13 S14 Q15 A16 K17 R18 V21 K22 Y24 E25 Q27 A31 G32 N33 I34 R37 R39 G40 T41 F43 G52 R53 D54 F55 F58 F67 R72 L73 R75
BS03	rna	Y0	R72 G73 R74	R70 G71 R72

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4w4g, PDBe:4w4g, PDBj:4w4g
• PDBsum: 4w4g
• PubMed: 26508639
• UniProt: P60493|RL27_THET8 Large ribosomal subunit protein bL27 (Gene Name=rpmA)