Structure of PDB 1vvj Chain Y0

Receptor sequence

>1vvjY0 (length=82) Species: 300852 (Thermus thermophilus HB8)

AHKKGLGSTRNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNV
GMGRDFTLFALVDGVVEFQDRGRLGRYVHVRP

3D structure

• PDB: 1vvj Structural insights into +1 frameshifting promoted by expanded or modification-deficient anticodon stem loops.
• Chain: Y0
• Resolution: 3.44 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Y0	A2 G6	A1 G5
BS02	rna	Y0	H3 N12 R14 D15 S16 Q17 A18 K19 R20 K24 Y26 E27 Q29 R32 A33 G34 N35 I36 R39 R41 G42 T43 R44 G54 R55 D56 F57 T58 F60 F69 R74 L75 R77	H2 N11 R13 D14 S15 Q16 A17 K18 R19 K23 Y25 E26 Q28 R31 A32 G33 N34 I35 R38 R40 G41 T42 R43 G53 R54 D55 F56 T57 F59 F68 R73 L74 R76
BS03	rna	Y0	R72 G73 R74	R71 G72 R73

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:1vvj, PDBe:1vvj, PDBj:1vvj
• PDBsum: 1vvj
• PubMed: 25128388
• UniProt: P60493|RL27_THET8 Large ribosomal subunit protein bL27 (Gene Name=rpmA)