Structure of PDB 8uua Chain Y

Receptor sequence

>8uuaY (length=76) Species: 1642 (Listeria innocua) [Search protein sequence]

GSTSNGRDSESKRLGAKRADGQFVTGGSILYRQRGTKIYPGTNVGRGGDD
TLFAKTDGVVRFERMGRDKKKVSVYP

3D structure

PDB

8uua Mechanistic insights into the alternative ribosome recycling by HflXr.

Chain

Resolution

2.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Y	T18 N20 R22 D23 S24 E25 S26 K27 R28 L29 K32 A34 D35 Q37 T40 G41 G42 S43 I44 Y46 R47 R49 G50 T51 Y54 G62 G63 D64 F68 F77 K84 K85	T3 N5 R7 D8 S9 E10 S11 K12 R13 L14 K17 A19 D20 Q22 T25 G26 G27 S28 I29 Y31 R32 R34 G35 T36 Y39 G47 G48 D49 F53 F62 K69 K70

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links