Structure of PDB 8uu9 Chain Y

Receptor sequence
>8uu9Y (length=76) Species: 1642 (Listeria innocua) [Search protein sequence]
STSNGRDSESKRLGAKRADGQFVTGGSILYRQRGTKIYPGTNVGRGGDDT
LFAKTDGVVRFERMGRDKKKVSVYPE
3D structure
PDB8uu9 Mechanistic insights into the alternative ribosome recycling by HflXr.
ChainY
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Y N20 R22 D23 S24 E25 S26 K27 R28 L29 A34 D35 Q37 G41 G42 S43 I44 Y46 R47 R49 G50 T51 K52 Y54 G62 G63 D64 F68 F77 K85 N4 R6 D7 S8 E9 S10 K11 R12 L13 A18 D19 Q21 G25 G26 S27 I28 Y30 R31 R33 G34 T35 K36 Y38 G46 G47 D48 F52 F61 K69
BS02 rna Y R79 R82 R63 R66
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8uu9, PDBe:8uu9, PDBj:8uu9
PDBsum8uu9
PubMed38407413
UniProtA0A660JMC7

[Back to BioLiP]