Structure of PDB 8uu8 Chain Y

Receptor sequence
>8uu8Y (length=76) Species: 1642 (Listeria innocua) [Search protein sequence]
GSTSNGRDSESKRLGAKRADGQFVTGGSILYRQRGTKIYPGTNVGRGGDD
TLFAKTDGVVRFERMGRDKKKVSVYP
3D structure
PDB8uu8 Mechanistic insights into the alternative ribosome recycling by HflXr.
ChainY
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Y S17 T18 N20 R22 S24 E25 S26 K27 R28 L29 A34 D35 G41 G42 S43 I44 R47 R49 G50 Y54 G62 G63 D64 F68 F77 K85 S2 T3 N5 R7 S9 E10 S11 K12 R13 L14 A19 D20 G26 G27 S28 I29 R32 R34 G35 Y39 G47 G48 D49 F53 F62 K70
BS02 rna Y R79 R82 R64 R67
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8uu8, PDBe:8uu8, PDBj:8uu8
PDBsum8uu8
PubMed38407413
UniProtA0A660JMC7

[Back to BioLiP]