Structure of PDB 8ur0 Chain Y |
>8ur0Y (length=141) Species: 562 (Escherichia coli) [Search protein sequence] |
AKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEK GLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKI SRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVED |
|
PDB | 8ur0 Escherichia coli transcription-translation coupled complex class A (TTC-A) containing RfaH bound to ops signal, mRNA with a 21 nt long spacer, and fMet-tRNAs in E-site and P-site of the ribosome |
Chain | Y |
Resolution | 3.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
Y |
R126 S134 |
R126 S134 |
|
|
|
|