Structure of PDB 8s8j Chain Y

Receptor sequence

>8s8jY (length=134) Species: 284590 (Kluyveromyces lactis NRRL Y-1140)

SDAITIRTRKVISNPLLARKQFVVDVLHPNRANVSKDELREKLAEAYKAE
KDAVSVFGFRTQYGGGKSTGFGLVYNSVADAKKFEPAYRLVRYGLAEKVE
KASRQQRKQRKNRGKKIFGTGKSIAKKAARRNAD

3D structure

• PDB: 8s8j Structural basis of AUC codon discrimination during translation initiation in yeast.
• Chain: Y
• Resolution: 4.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Y	R8 T9 R10 K11 V12 N34 S36 K37 F58 G59 F60 T62 Q63 Y64 G65 Y89 R93 K102 R105 K109 Q110 K112 N113 K116 K117 F119 G120 T121 K123 R131 R132	R7 T8 R9 K10 V11 N33 S35 K36 F57 G58 F59 T61 Q62 Y63 G64 Y88 R92 K101 R104 K108 Q109 K111 N112 K115 K116 F118 G119 T120 K122 R130 R131

External links

• PDB: RCSB:8s8j, PDBe:8s8j, PDBj:8s8j
• PDBsum: 8s8j
• PubMed: 39193907
• UniProt: Q6CU44