Structure of PDB 8s8h Chain Y

Receptor sequence

>8s8hY (length=134) Species: 284590 (Kluyveromyces lactis NRRL Y-1140)

SDAITIRTRKVISNPLLARKQFVVDVLHPNRANVSKDELREKLAEAYKAE
KDAVSVFGFRTQYGGGKSTGFGLVYNSVADAKKFEPAYRLVRYGLAEKVE
KASRQQRKQRKNRGKKIFGTGKSIAKKAARRNAD

3D structure

• PDB: 8s8h Structural basis of AUC codon discrimination during translation initiation in yeast.
• Chain: Y
• Resolution: 4.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Y	R8 T9 R10 K11 V12 A33 N34 S36 K37 F58 G59 F60 T62 Q63 Y64 G65 G66 Y89 R93 R105 Q106 K109 K112 N113 K116 K117 G120 T121 K127 K128 R131 R132	R7 T8 R9 K10 V11 A32 N33 S35 K36 F57 G58 F59 T61 Q62 Y63 G64 G65 Y88 R92 R104 Q105 K108 K111 N112 K115 K116 G119 T120 K126 K127 R130 R131

External links

• PDB: RCSB:8s8h, PDBe:8s8h, PDBj:8s8h
• PDBsum: 8s8h
• PubMed: 39193907
• UniProt: Q6CU44