Structure of PDB 8s1p Chain Y

Receptor sequence
>8s1pY (length=65) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
MKANEIRDLTTAEIEQKVKSLKEELFNLRFQLATGQLENTARIREVRKAI
ARMKTVIREREIAAN
3D structure
PDB8s1p A role for the S4-domain containing protein YlmH in ribosome-associated quality control in Bacillus subtilis.
ChainY
Resolution1.96 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Y A3 R7 N39 T40 A41 R44 R47 K48 A51 R52 K54 T55 R58 E59 I62 A3 R7 N39 T40 A41 R44 R47 K48 A51 R52 K54 T55 R58 E59 I62
Gene Ontology
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8s1p, PDBe:8s1p, PDBj:8s1p
PDBsum8s1p
PubMed38811035
UniProtP12873|RL29_BACSU Large ribosomal subunit protein uL29 (Gene Name=rpmC)

[Back to BioLiP]