Structure of PDB 8qbn Chain Y |
>8qbnY (length=119) Species: 9606 (Homo sapiens) [Search protein sequence] |
GRIFLDHIGGTRLFSCANCDTILTNRSELISTRFTGATGRAFLFNKVVNL QYSEVQDRVMLTGRHMVRDVSCKNCNSKLGWIYEFATEDSQRYKEGRVIL ERALVRESEGFEEHVPSDN |
|
PDB | 8qbn Non-canonical substrate targeting by the supramolecular CTLH E3 ligase reveals an WDR26-YPEL5 regulatory module |
Chain | Y |
Resolution | 3.2 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
Y |
C17 C73 C76 |
C16 C72 C75 |
|
|
|
|