Structure of PDB 8q84 Chain Y

Receptor sequence
>8q84Y (length=72) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
MENPHEQVQANILSRIIGNVKRLNESVAILNQELVTINNRNKNLEIMGAI
CDNYHSSVQFNLEATNNKKPPL
3D structure
PDB8q84 Structural mechanism of outer kinetochore Dam1-Ndc80 complex assembly on microtubules
ChainY
Resolution3.15 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide Y R22 S26 R22 S26
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008017 microtubule binding
GO:0051010 microtubule plus-end binding
Biological Process
GO:0007059 chromosome segregation
GO:0008608 attachment of spindle microtubules to kinetochore
GO:0031116 positive regulation of microtubule polymerization
GO:0051301 cell division
GO:0051987 positive regulation of attachment of spindle microtubules to kinetochore
GO:1990758 mitotic sister chromatid biorientation
GO:1990976 protein transport along microtubule to mitotic spindle pole body
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000776 kinetochore
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005819 spindle
GO:0005856 cytoskeleton
GO:0005874 microtubule
GO:0042729 DASH complex
GO:0072686 mitotic spindle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8q84, PDBe:8q84, PDBj:8q84
PDBsum8q84
PubMed38060647
UniProtP69851|DAD4_YEAST DASH complex subunit DAD4 (Gene Name=DAD4)

[Back to BioLiP]