Structure of PDB 8iwx Chain Y

Receptor sequence

>8iwxY (length=218) Species: 3562 (Spinacia oleracea)

SPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRE
LEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYL
GNPSLVHAQSILAIWACQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDP
LGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHL
ADPVNNNAWNFATNFVPG

3D structure

• PDB: 8iwx Cryo-EM structures of LHCII in photo-active and photo-protecting states reveal allosteric regulation of light harvesting and excess energy dissipation.
• Chain: Y
• Resolution: 2.59 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CHL	Y	A225 F228 P230	A212 F215 P217
BS02	CHL	Y	W46 T48	W33 T35
BS03	CHL	Y	Y24 L25 Y44	Y11 L12 Y31
BS04	CLA	Y	L36 G42 D43 Y44 W46 D47 L51 S52 F58 N61 R62 E65 H68 R185 M188 F189 F192	L23 G29 D30 Y31 W33 D34 L38 S39 F45 N48 R49 E52 H55 R172 M175 F176 F179
BS05	CLA	Y	L64 H68	L51 H55
BS06	CLA	Y	G78 P82 F92 Q103 L110 Y112 L113 L118 V119	G65 P69 F79 Q90 L97 Y99 L100 L105 V106
BS07	CHL	Y	L118 V119 H120 Q122 S123	L105 V106 H107 Q109 S110
BS08	CHL	Y	Q131 M135	Q118 M122
BS09	CHL	Y	W97 F98 K99 G101 S102 Q131 I199	W84 F85 K86 G88 S89 Q118 I186
BS10	CHL	Y	R70 W71 L74 V138 Y141 R142 G146 P147 L148 P157 F161	R57 W58 L61 V125 Y128 R129 G133 P134 L135 P144 F148
BS11	CHL	Y	L64 I67 H68 W71 M135 G136 E139 F192	L51 I54 H55 W58 M122 G123 E126 F179
BS12	CLA	Y	R70 M73 Y156 F161 L166 F173 L176 E180	R57 M60 Y143 F148 L153 F160 L163 E167
BS13	CLA	Y	W16 K179 K182 N183	W3 K166 K169 N170
BS14	CLA	Y	K179 N183 L186	K166 N170 L173
BS15	CLA	Y	F189 F192 G193 V196 Q197 N208 H212 N220 A221	F176 F179 G180 V183 Q184 N195 H199 N207 A208
BS16	CLA	Y	H212 P216 N220 W222	H199 P203 N207 W209

Gene Ontology

Biological Process

• GO:0009765 photosynthesis, light harvesting

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:8iwx, PDBe:8iwx, PDBj:8iwx
• PDBsum: 8iwx
• PubMed: 37653340
• UniProt: P12333|CB2A_SPIOL Chlorophyll a-b binding protein, chloroplastic