Structure of PDB 8i0r Chain Y

Receptor sequence
>8i0rY (length=118) Species: 9606 (Homo sapiens) [Search protein sequence]
MNPLTKVKLINELNEREVQLGVADKVSWHSEYKDSAWIFLGGLPYELTEG
DIICVFSQYGEIVNINLVRDKKTGKSKGFCFLCYEDQRSTILAVDNFNGI
KIKGRTIRVDHVSNYRAP
3D structure
PDB8i0r Molecular Basis for the activation of Human spliceosome
ChainY
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Y M1 N2 P3 L4 T5 K8 F39 F79 F81 R105 R116 A117 P118 M1 N2 P3 L4 T5 K8 F39 F79 F81 R105 R116 A117 P118
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005686 U2 snRNP
GO:0005730 nucleolus
GO:0005783 endoplasmic reticulum
GO:0031965 nuclear membrane
GO:0071005 U2-type precatalytic spliceosome
GO:0071011 precatalytic spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8i0r, PDBe:8i0r, PDBj:8i0r
PDBsum8i0r
PubMed39068178
UniProtQ9Y388|RBMX2_HUMAN RNA-binding motif protein, X-linked 2 (Gene Name=RBMX2)

[Back to BioLiP]