Structure of PDB 8ev3 Chain Y

Receptor sequence

>8ev3Y (length=125) Species: 4896 (Schizosaccharomyces pombe)

MKFSRDVTSSRRKQRKAHFGAPSSVRRVLMSAPLSKELREQYKIRSLPVR
RDDQITVIRGSNKGREGKITSVYRKKFLLLIERVTREKANGASAPVGIDA
SKVVITKLHLDKDRKDLIVRKGGKV

3D structure

• PDB: 8ev3 Chromatin localization of nucleophosmin organizes ribosome biogenesis.
• Chain: Y
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	Y	M1 K2 F3 S4 R5 T8 S9 R11 K13 Q14 R15 H18 V28 L29 S31 P33 R45 S46 R59 G60 S61 R86 K88 A89 N90 D99 S101 K102 R120 K121	M1 K2 F3 S4 R5 T8 S9 R11 K13 Q14 R15 H18 V28 L29 S31 P33 R45 S46 R59 G60 S61 R86 K88 A89 N90 D99 S101 K102 R120 K121
BS02	rna	Y	R12 R15 K16 F19 S23 S24 R27 R50 R51 V72 Y73 R74 K75 D113 L117	R12 R15 K16 F19 S23 S24 R27 R50 R51 V72 Y73 R74 K75 D113 L117

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0042273 ribosomal large subunit biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8ev3, PDBe:8ev3, PDBj:8ev3
• PDBsum: 8ev3
• PubMed: 36423630
• UniProt: P78946|RL26_SCHPO Large ribosomal subunit protein uL24 (Gene Name=rpl26)